PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G01215.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 292aa    MW: 33364.8 Da    PI: 10.2911
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G01215.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3543e-1742126186
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                     ++k+ ++ ++l++  l l  +f++++g+ + + +tl+    s  sW+v  i  k+ ++y+l kGW++F+++n Lk gD+++F +++
  Pahal.G01215.1  42 WIKKVINGHTLEKY-LALATDFCDAIGLRESCMITLKTSMDSTGSWQVCGISIKNCRSYLLIKGWRRFCQENSLKKGDICTFNVIE 126
                     67888888888886.**************88877777666888***************************************9765 PP

2B346.75.9e-15199280286
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                     +k++++  + ++  l+lp  f++++g+ +++++tl+   +s  sW+ ++i  ++s+++v  +G  +F+++ng+k+gD+++Fk ++
  Pahal.G01215.1 199 IKKEINMWAIRNT-LYLPPVFCKAIGIREPCKITLKTSMSSITSWQARVIPYNHSSHHV--NGLTRFCQDNGIKVGDVCTFKIVD 280
                     6667676677665.*************999977777666777*******9899998886..89*******************654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019366.47E-1836138IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.7E-1937136IPR015300DNA-binding pseudobarrel domain
CDDcd100171.78E-1040122No hitNo description
PROSITE profilePS5086310.91241138IPR003340B3 DNA binding domain
SMARTSM010193.9E-543138IPR003340B3 DNA binding domain
PfamPF023623.4E-1349127IPR003340B3 DNA binding domain
SuperFamilySSF1019361.88E-14195288IPR015300DNA-binding pseudobarrel domain
SMARTSM010190.0052199291IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.0E-14208288IPR015300DNA-binding pseudobarrel domain
CDDcd100171.36E-8208277No hitNo description
PfamPF023621.1E-12209288IPR003340B3 DNA binding domain
PROSITE profilePS508638.445210291IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MHMSKNKWSR SKRNKRLDGS RSSLNKAAFH RKSFYEIGPP SWIKKVINGH TLEKYLALAT  60
DFCDAIGLRE SCMITLKTSM DSTGSWQVCG ISIKNCRSYL LIKGWRRFCQ ENSLKKGDIC  120
TFNVIETTVW HVIITRYKEQ IDLPCYLQEK PSGSSMKRKR VNNRSSNEEQ KSSKGSMISW  180
CKASSKTGCI FEIGPPAWIK KEINMWAIRN TLYLPPVFCK AIGIREPCKI TLKTSMSSIT  240
SWQARVIPYN HSSHHVNGLT RFCQDNGIKV GDVCTFKIVD TTLWHVIIEP R*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0A9S1933e-98A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012124m5e-67(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-10B3 family protein